DES humano 1mg de los péptidos IGF-1 del crecimiento de CAS 946870-92-4 Insulina-como el factor de crecimiento IGF-1 LARGO

Informacion basica
Lugar de origen: China
Nombre de la marca: GSP
Certificación: ISO9001,SGS,UKAS,GMP
Número de modelo: DES IGF-1
Cantidad de orden mínima: Muestras libres disponibles
Precio: Negotiable
Detalles de empaquetado: 10iu/vial, 10vials/kit
Tiempo de entrega: 3-6 días laborables
Condiciones de pago: Western Union, MoneyGram, T/T, Bitcoins
Capacidad de la fuente: 10000-30000iu/month
Alias: IGF-1 R3 largo Especificaciones: 0.1mg, 1mg, 1g
Sinónimos: R3-IGF-1 largo Embalaje: Embalaje discreto para el paso de aduanas garantizado
Aspecto: Polvo liofilizado blanco CAS: 946870-92-4
Correo electrónico: tonyraws810@gmail.com WhatsApp: 86-15871352379
Wickr: tonyraws
Alta luz:

Péptidos del edificio del músculo

,

péptidos de la hormona de crecimiento

Recombinante humano del DES de IGF-I (1-3) producido en Escherichia Coli es una cadena sola, no-glycosylated, del polipéptido que contiene 67 aminoácidos (aa 4-70) y que tiene una masa molecular de 7368,5 Dalton.
IGF-1 Des1-3 es purificado por técnicas cromatográficas propietarias.

 

DES humano 1mg de los péptidos IGF-1 del crecimiento Insulina-como el factor de crecimiento IGF-1 LARGO

 

Insulina-como DES del crecimiento Factor-1 (1-3):

 

Secuencia

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK

PAKSA

Sinónimos

Somatomedin C, IGF-I, IGFI, IGF1, IGF-IA, factor de crecimiento de Mechano, MGF, DES (1-3), Des1-3,

DES 1-3, DES (1-3), IGF-1 (4-70).

Aspecto físico Polvo (liofilizado) liofilizado blanco filtrado estéril
Solubilidad

Se recomienda para reconstituir el DES de IGF-I (1-3) en 18M-cm estéril H2O no menos que

100µg/ml, que se puede entonces diluir más a fondo a otras soluciones acuosas.

Pureza Mayor de 97,0% según lo determinado cerca:
(a) análisis por RP-HPLC.
(b) análisis por SDS-PAGE.
Uso

Los productos de ProSpec se suministran para el USO de la INVESTIGACIÓN del LABORATORIO SOLAMENTE. El producto

no se pueden utilizar como drogas, los productos agrícolas o pesticidas, los aditivos alimenticios o las sustancias químicas de hogar.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Descripciones:

 

El DES IGF-1 es la versión más corta de la cadena IGF-1. Es cinco (5) veces más potente que IGF-LR3 y diez (10) las épocas más potentes que la base regular IGF-1. La semivida para el DES es cerca de 20-30 minutos, que significa que esto es una cadena muy delicada. Por lo tanto, la administración debe ser hecha solamente en el sitio en donde usted quiere ver crecimiento del músculo. El DES tiene la capacidad de estimular la hiperplasia del músculo mejor que LR3. En términos simples, se utiliza mejor para las inyecciones del sitio, bastante que crecimiento total.

 

Además, el DES se sabe para atar a los receptores que han sido deformados por el ácido láctico, que está a menudo presente durante entrenamientos. Esto permite que el DES se ate a un crecimiento transformado del tejido del receptor y de la señal durante el entrenamiento. El DES se puede utilizar más de largo y más con frecuencia que LR3.

 

DES IGF1:

 

La insulina como el factor de crecimiento (IGF) - 1 (4-70), conocido de otra manera como DES IGF-1, producido en Escherichia Coli, es una cadena sola, no-glycosylated, del polipéptido que contiene 67 aminoácidos y que tiene una masa molecular de 7.372 DA. Los estudios ines vitro demuestran que en DES igual de las dosis (1-3) IGF es diez veces más potente que IGF-1 en la hipertrofia estimulante y la proliferación en células cultivadas. Es probable generado con la modificación poste-de translación en la secuencia de IGF-1 maduro de circulación vía la acción de la proteasa.

 

El DES IGF-1 es una forma hendida de IGF-1 y contiene los aminoácidos 4-70. Esta estructura ha permitido que los efectos de la proteína IGF-1 sean amplificados en la forma más estable del fragmento de la proteína del péptido de la molécula del DES 1,3 Insulina-como del factor de crecimiento 1. El DES IGF-1, o insulina-como el DES del factor de crecimiento, viene de la familia IGF-1 de péptidos que desempeñen papeles importantes en crecimiento y el desarrollo mamíferos. IGF1 media muchos de los efectos animadores del crecimiento de la hormona de crecimiento y de DES IGF-1, aunque sea más corto, los pactos una misma cantidad de cambios físicos de alteración fisiológicos de la proteína. Los estudios tempranos mostraron que la hormona de crecimiento no estimuló directamente la incorporación del sulfato en el cartílago, pero actuaban bastante con un factor del suero, llamaron el ‘factor de la sulfatación,’ que más adelante se conocía como ‘somatomedin’ o IGF-1 y más recientemente con el truncamiento, DES IGF-1.

 

DES humano 1mg de los péptidos IGF-1 del crecimiento de CAS 946870-92-4 Insulina-como el factor de crecimiento IGF-1 LARGO 0

 

Dosificación:

 

El DES IGF-1 se puede dosificar en las horas múltiples 50-150mcg al día (antes del entrenamiento) en áreas de objetivo específico. puesto que el DES tiene una semivida tan corta (20-30 minutos), la desensibilización no fue notada en absoluto. Los sitios de la inyección deben ser localizados; preferiblemente, en el grupo del músculo usted quiere crecer. En términos simples, si usted quiere crecer su bíceps, inyecte la derecha del DES IGF-1 en su bíceps.

 

IGF-1 contra HGH:

 

¿Porqué IGF-1 y no GH? La hormona de crecimiento es realmente un precursor a IGF-1. La hormona de crecimiento no causa directamente crecimiento del músculo, sino causa indirectamente crecimiento del músculo señalando el lanzamiento de IGF-1. La hormona de crecimiento humano (HGH) puede ser muy costosa, y ver crecimiento del músculo que necesita ser emparejada con la insulina u otros esteroides anabólicos. Esto hace las variantes IGF-1 como LR3 y el DES, que se pueden utilizar como droga independiente, una opción mucho más viable para el culturista que mira para ver la recuperación sólida del crecimiento dañado del tejido y del músculo.

 

Grado del receptor contra el medios grado IGF-1 LR3:


El grado auténtico LR3 IGF-I del receptor es un reactivo de alta calidad de la investigación para el uso en estudios en crecimiento de la célula, receptores de IGF y proteínas obligatorias de IGF y es más potente que el derecho IGF-1 y medios grado IGF-1 LR3 in vivo y in vitro debido al aumento drástico en la actividad biológica (una afinidad más fuerte para atar con el receptor de IGF) y la pureza de alto nivel. Esta combinación de actividad biológica y de pureza crecientes es qué fija el grado IGF-1 LR3 del receptor aparte de IGF-1 estándar. El medios grado LR3 IGF-I se utiliza generalmente en cultivo celular comercial contra mamífero. Puede también ser utilizado como reactivo de la investigación en un coste económico para permitir estudios donde está la potencia biológica de menos valor y se requieren cantidades más altas. Para maximizar resultados en un grado animal-basado IGF-1 R3 largo del receptor del estudio o de la producción de la célula se debe utilizar exclusivamente.

 

¿Usted tiene política del reenvío?

 

Hacemos que el buenos servicio de la después-venta y política del reenvío si el paquete pierdan.
Nuestra asociación larga con nuestros clientes ha traído grandes ventajas.
Tomamos siempre el cuidado upmost en el empaquetado de nuestros productos.
Nuestros clientes confirmarán esto tan incluso que luchan para encontrarlos sin ayuda a veces.
Pero a pesar de nuestros mejores esfuerzos que es todavía posible agarrará una pequeña cantidad de paquetes.
En esta circunstancia prometemos reenviamos libre de establecer la relación a largo plazo.

 

Envío:

 

1. Preferencial DHL o HKEMS para la cantidad menos que 50KG;
2. envío del mar para la cantidad sobre 60KG. ¡el 100% seguro!
3. envíe de nuestro agente en Países Bajos, Singapur, Laos, los E.E.U.U.

 

Cualquier necesidad, me entra en contacto con por favor

Correo electrónico: tonyraws810@gmail.com

Whatsapp: 86-15871352379

Wickr: tonyraws

Contacto
Sales Manager

Número de teléfono : +8613657291547

WhatsApp : +https://api.whatsapp.com/send?phone=8615871352379